Lineage for d2z4kh1 (2z4k H:2-128)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647137Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2647186Domain d2z4kh1: 2z4k H:2-128 [154059]
    Other proteins in same PDB: d2z4kb1, d2z4kc1, d2z4kc2, d2z4kd1, d2z4ke1, d2z4ke2, d2z4kf1, d2z4kg1, d2z4ki1, d2z4kj1, d2z4kk1, d2z4kl1, d2z4km1, d2z4kn1, d2z4kp1, d2z4kq1, d2z4kr1, d2z4ks1, d2z4kt1, d2z4ku1
    protein/RNA complex; complexed with mg, par
    protein/RNA complex; complexed with mg, par

Details for d2z4kh1

PDB Entry: 2z4k (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2z4kh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4kh1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
geiicyv

SCOPe Domain Coordinates for d2z4kh1:

Click to download the PDB-style file with coordinates for d2z4kh1.
(The format of our PDB-style files is described here.)

Timeline for d2z4kh1: