SCOPe 2.07: Domain d2z49b3: 2z49 B:284-432

Lineage for d2z49b3 (2z49 B:284-432)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.281: Hemolytic lectin CEL-III, C-terminal domain [111264] (1 superfamily)
   unusual fold

4. Superfamily d.281.1: Hemolytic lectin CEL-III, C-terminal domain [111265] (1 family)

5. Family d.281.1.1: Hemolytic lectin CEL-III, C-terminal domain [111266] (1 protein)

6. Protein Hemolytic lectin CEL-III, C-terminal domain [111267] (1 species)

7. Species Cucumaria echinata [TaxId:40245] [111268] (4 PDB entries)
   Uniprot Q868M7 11-442

8. Domain d2z49b3: 2z49 B:284-432 [154047]
   Other proteins in same PDB: d2z49a1, d2z49a2, d2z49b1, d2z49b2
   automated match to d1vcla3
   complexed with amg, ca, mg

Details for d2z49b3

PDB Entry: 2z49, 1.95 Å

PDB Description: crystal structure of hemolytic lectin cel-iii complexed with methyl- alpha-d-galactopylanoside

PDB Compounds: (B:) hemolytic lectin CEL-III

SCOPe Domain Sequences for d2z49b3:

Sequence; same for both SEQRES and ATOM records:

>d2z49b3 d.281.1.1 (B:284-432) Hemolytic lectin CEL-III, C-terminal domain {Cucumaria echinata [TaxId: 40245]}
ddwevptatwnmvgcdqngkvsqqisntisfsstvtagvavevsstiekgvifakatvsv
kvtaslskawtnsqsgttaitytcdnydsdeeftrgcmwqlaiettevksgdllvwnpqi
vkctrsntapgcapftkcanedctfctdi

Timeline for d2z49b3:

• d2z49b3 first appeared in SCOP 1.75
  
• d2z49b3 appears in SCOPe 2.06
  
• d2z49b3 appears in the current release, SCOPe 2.08