SCOPe 2.01: Domain d2z3ya3: 2z3y A:655-763

Lineage for d2z3ya3 (2z3y A:655-763)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159954] (8 PDB entries)
   Uniprot O60341 655-763

8. Domain d2z3ya3: 2z3y A:655-763 [154026]
   Other proteins in same PDB: d2z3ya1, d2z3ya2
   automatically matched to 2IW5 A:655-763
   complexed with f2n

Details for d2z3ya3

PDB Entry: 2z3y, 2.25 Å

PDB Description: Crystal structure of Lysine-specific demethylase1

PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2z3ya3:

Sequence; same for both SEQRES and ATOM records:

>d2z3ya3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

Timeline for d2z3ya3:

• d2z3ya3 first appeared in SCOP 1.75
  
• d2z3ya3 appears in SCOPe 2.02
  
• d2z3ya3 appears in the current release, SCOPe 2.08