Class a: All alpha proteins [46456] (284 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Interleukin-15 (IL-15) [158422] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries) Uniprot P40933 49-162 |
Domain d2z3ra_: 2z3r A: [154006] Other proteins in same PDB: d2z3rb1, d2z3rd1, d2z3rf1, d2z3rh1, d2z3rj1, d2z3rl1, d2z3rn1, d2z3rp1 automated match to d2z3qa1 complexed with gol |
PDB Entry: 2z3r (more details), 2 Å
SCOPe Domain Sequences for d2z3ra_:
Sequence, based on SEQRES records: (download)
>d2z3ra_ a.26.1.2 (A:) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]} amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfin
>d2z3ra_ a.26.1.2 (A:) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]} amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg dasihdtvenliilannslsstesgckeceeleeknikeflqsfvhivqmfin
Timeline for d2z3ra_: