SCOPe 2.03: Domain d2z3qc_: 2z3q C:

Lineage for d2z3qc_ (2z3q C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-15 (IL-15) [158422] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries)
   Uniprot P40933 49-162

8. Domain d2z3qc_: 2z3q C: [154004]
   Other proteins in same PDB: d2z3qb1, d2z3qd_
   automated match to d2z3qa1

Details for d2z3qc_

PDB Entry: 2z3q, 1.85 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex

PDB Compounds: (C:) Interleukin-15

SCOPe Domain Sequences for d2z3qc_:

Sequence; same for both SEQRES and ATOM records:

>d2z3qc_ a.26.1.2 (C:) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfin

Timeline for d2z3qc_:

• d2z3qc_ first appeared in SCOP 1.75, called d2z3qc1
  
• d2z3qc_ appears in SCOPe 2.02
  
• d2z3qc_ appears in SCOPe 2.04
  
• d2z3qc_ appears in the current release, SCOPe 2.08, called d2z3qc2