Lineage for d2z3qc2 (2z3q C:1-112)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705596Protein Interleukin-15 (IL-15) [158422] (2 species)
  7. 2705597Species Human (Homo sapiens) [TaxId:9606] [158423] (3 PDB entries)
    Uniprot P40933 49-162
  8. 2705599Domain d2z3qc2: 2z3q C:1-112 [154004]
    Other proteins in same PDB: d2z3qa2, d2z3qb1, d2z3qb2, d2z3qc3, d2z3qd2, d2z3qd3
    automated match to d2z3qa1

Details for d2z3qc2

PDB Entry: 2z3q (more details), 1.85 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex
PDB Compounds: (C:) Interleukin-15

SCOPe Domain Sequences for d2z3qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3qc2 a.26.1.2 (C:1-112) Interleukin-15 (IL-15) {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfin

SCOPe Domain Coordinates for d2z3qc2:

Click to download the PDB-style file with coordinates for d2z3qc2.
(The format of our PDB-style files is described here.)

Timeline for d2z3qc2: