SCOPe 2.04: Domain d2z3qb1: 2z3q B:1-78

Lineage for d2z3qb1 (2z3q B:1-78)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Interleukin-15 receptor subunit alpha [161139] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries)
   Uniprot Q13261 31-108! Uniprot Q13261 31-96

8. Domain d2z3qb1: 2z3q B:1-78 [154003]
   Other proteins in same PDB: d2z3qa1, d2z3qc_

Details for d2z3qb1

PDB Entry: 2z3q, 1.85 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex

PDB Compounds: (B:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2z3qb1:

Sequence; same for both SEQRES and ATOM records:

>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps
lkcirdpalvhqrpapps

Timeline for d2z3qb1:

• d2z3qb1 first appeared in SCOP 1.75
  
• d2z3qb1 appears in SCOPe 2.03
  
• d2z3qb1 appears in SCOPe 2.05
  
• d2z3qb1 appears in the current release, SCOPe 2.08