![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.22: ASF1-like [101546] (1 family) ![]() contains extra C-terminal strand |
![]() | Family b.1.22.1: ASF1-like [101547] (2 proteins) |
![]() | Protein Anti-silencing protein 1, ASF1 [101548] (3 species) |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries) Uniprot O74515 1-161 |
![]() | Domain d2z3fc1: 2z3f C:2-161 [153988] automatically matched to 2CU9 A:1-161 |
PDB Entry: 2z3f (more details), 2.7 Å
SCOPe Domain Sequences for d2z3fc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3fc1 b.1.22.1 (C:2-161) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemegl nlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn
Timeline for d2z3fc1: