Lineage for d2z34b1 (2z34 B:2-160)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376463Superfamily b.1.22: ASF1-like [101546] (2 families) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 2376464Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 2376465Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 2376470Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries)
    Uniprot O74515 1-161
  8. 2376475Domain d2z34b1: 2z34 B:2-160 [153958]
    automatically matched to 2CU9 A:1-161

Details for d2z34b1

PDB Entry: 2z34 (more details), 2.4 Å

PDB Description: Crystal structure of SpCia1/Asf1 complex with Hip1
PDB Compounds: (B:) Histone chaperone cia1

SCOPe Domain Sequences for d2z34b1:

Sequence, based on SEQRES records: (download)

>d2z34b1 b.1.22.1 (B:2-160) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll
vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemegl
nlqemddaeikkvkvdiskvwrsilaekprvtrfniqwd

Sequence, based on observed residues (ATOM records): (download)

>d2z34b1 b.1.22.1 (B:2-160) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll
vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeei
kkvkvdiskvwrsilaekprvtrfniqwd

SCOPe Domain Coordinates for d2z34b1:

Click to download the PDB-style file with coordinates for d2z34b1.
(The format of our PDB-style files is described here.)

Timeline for d2z34b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2z34a1