Lineage for d2z2mf2 (2z2m F:693-750)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636204Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 1636205Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) (S)
    duplication: consists of 2 subdomains of this fold
  5. 1636206Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 1636207Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 1636208Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)
  8. 1636216Domain d2z2mf2: 2z2m F:693-750 [153948]
    Other proteins in same PDB: d2z2mb_, d2z2me_
    automated match to d1qmea2
    complexed with cds, so4

Details for d2z2mf2

PDB Entry: 2z2m (more details), 2.6 Å

PDB Description: cefditoren-acylated penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae
PDB Compounds: (F:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2z2mf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z2mf2 d.11.1.1 (F:693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd

SCOPe Domain Coordinates for d2z2mf2:

Click to download the PDB-style file with coordinates for d2z2mf2.
(The format of our PDB-style files is described here.)

Timeline for d2z2mf2: