SCOPe 2.08: Domain d2z1fa1: 2z1f A:43-155

Lineage for d2z1fa1 (2z1f A:43-155)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)

6. Protein Hydrogenase expression/formation protein HypE [160513] (1 species)

7. Species Thermococcus kodakaraensis [TaxId:311400] [160514] (3 PDB entries)
   Uniprot Q5JII7 41-155

8. Domain d2z1fa1: 2z1f A:43-155 [153934]
   Other proteins in same PDB: d2z1fa2
   automated match to d2z1ea1

Details for d2z1fa1

PDB Entry: 2z1f, 1.7 Å

PDB Description: Crystal structure of HypE from Thermococcus kodakaraensis (inward form)

PDB Compounds: (A:) Hydrogenase expression/formation protein HypE

SCOPe Domain Sequences for d2z1fa1:

Sequence; same for both SEQRES and ATOM records:

>d2z1fa1 d.79.4.1 (A:43-155) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]}
dgatipfgdkhivftidghtvkplffpggdigrlavsgtvndlavmgaepialansmiig
egldmevlkrvlksmdetarevpvpivtgdtkvvedkiemfvitagigiaehp

Timeline for d2z1fa1:

• d2z1fa1 first appeared in SCOP 1.75
  
• d2z1fa1 appears in SCOPe 2.07