![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.370: BTG domain-like [160695] (1 superfamily) alpha(2)-beta-alpha(2)-beta(3); four-helical bundle, capped at one end by an antiparallel beta-sheet, order:1234 |
![]() | Superfamily d.370.1: BTG domain-like [160696] (1 family) ![]() automatically mapped to Pfam PF07742 |
![]() | Family d.370.1.1: BTG domain-like [160697] (3 proteins) Pfam PF07742 |
![]() | Protein TOB1, N-terminal domain [160698] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [160699] (2 PDB entries) Uniprot P50616 1-115! Uniprot P50616 1-117 |
![]() | Domain d2z15a1: 2z15 A:10-126 [153921] |
PDB Entry: 2z15 (more details), 2.3 Å
SCOPe Domain Sequences for d2z15a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z15a1 d.370.1.1 (A:10-126) TOB1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mqleiqvalnfiisylynklprrrvnifgeelerllkkkyeghwypekpykgsgfrcihi gekvdpvieqaskesgldiddvrgnlpqdlsvwidpfevsyqigekgpvkvlyvddn
Timeline for d2z15a1: