Lineage for d2z0pa_ (2z0p A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1798840Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1799082Protein automated matches [190063] (3 species)
    not a true protein
  7. 1799088Species Human (Homo sapiens) [TaxId:9606] [187187] (8 PDB entries)
  8. 1799102Domain d2z0pa_: 2z0p A: [153912]
    automated match to d1b55a_
    complexed with 4pt, zn

Details for d2z0pa_

PDB Entry: 2z0p (more details), 2.58 Å

PDB Description: crystal structure of ph domain of bruton's tyrosine kinase
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d2z0pa_:

Sequence, based on SEQRES records: (download)

>d2z0pa_ b.55.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqil

Sequence, based on observed residues (ATOM records): (download)

>d2z0pa_ b.55.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqimeqisiierfpypfqvvydegplyvfspteelrkrwihqlkn
virynsdlvqkyhpcfwidgqylccsqtaknamgcqil

SCOPe Domain Coordinates for d2z0pa_:

Click to download the PDB-style file with coordinates for d2z0pa_.
(The format of our PDB-style files is described here.)

Timeline for d2z0pa_: