Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein automated matches [190063] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187187] (8 PDB entries) |
Domain d2z0pa_: 2z0p A: [153912] automated match to d1b55a_ complexed with 4pt, zn |
PDB Entry: 2z0p (more details), 2.58 Å
SCOPe Domain Sequences for d2z0pa_:
Sequence, based on SEQRES records: (download)
>d2z0pa_ b.55.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqil
>d2z0pa_ b.55.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki tcvetvvpeknppperqimeqisiierfpypfqvvydegplyvfspteelrkrwihqlkn virynsdlvqkyhpcfwidgqylccsqtaknamgcqil
Timeline for d2z0pa_: