Lineage for d2pghc_ (2pgh C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44046Protein Hemoglobin, alpha-chain [46486] (14 species)
  7. 44231Species Pig (Sus scrofa) [TaxId:9823] [46491] (2 PDB entries)
  8. 44235Domain d2pghc_: 2pgh C: [15389]
    Other proteins in same PDB: d2pghb_, d2pghd_

Details for d2pghc_

PDB Entry: 2pgh (more details), 2.8 Å

PDB Description: structure determination of aquomet porcine hemoglobin at 2.8 angstrom resolution

SCOP Domain Sequences for d2pghc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pghc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Pig (Sus scrofa)}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d2pghc_:

Click to download the PDB-style file with coordinates for d2pghc_.
(The format of our PDB-style files is described here.)

Timeline for d2pghc_: