| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (24 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [46491] (3 PDB entries) |
| Domain d2pghc_: 2pgh C: [15389] Other proteins in same PDB: d2pghb_, d2pghd_ complexed with hem |
PDB Entry: 2pgh (more details), 2.8 Å
SCOPe Domain Sequences for d2pghc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pghc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Pig (Sus scrofa) [TaxId: 9823]}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr
Timeline for d2pghc_: