Lineage for d2yz4a_ (2yz4 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2373045Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2373066Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (61 PDB entries)
    Uniprot P81461
  8. 2373168Domain d2yz4a_: 2yz4 A: [153837]
    automated match to d1apna_
    complexed with ca, dod, mn

Details for d2yz4a_

PDB Entry: 2yz4 (more details), 2.2 Å

PDB Description: the neutron structure of concanavalin a at 2.2 angstroms
PDB Compounds: (A:) concanavalin a

SCOPe Domain Sequences for d2yz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yz4a_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d2yz4a_:

Click to download the PDB-style file with coordinates for d2yz4a_.
(The format of our PDB-style files is described here.)

Timeline for d2yz4a_: