Lineage for d2yx2a2 (2yx2 A:7-337)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430315Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 2430316Superfamily b.108.1: Phage fibre proteins [69349] (6 families) (S)
  5. 2430354Family b.108.1.5: HylP-like [159317] (1 protein)
    Pfam PF07212
  6. 2430355Protein Phage-associated hyaluronidase, HylP1 [159318] (1 species)
  7. 2430356Species Streptococcus pyogenes [TaxId:1314] [159319] (7 PDB entries)
    Uniprot Q9A0M7 7-336! Uniprot Q9A0M7 7-337
  8. 2430360Domain d2yx2a2: 2yx2 A:7-337 [153816]
    Other proteins in same PDB: d2yx2a3
    automated match to d2dp5a1

Details for d2yx2a2

PDB Entry: 2yx2 (more details), 2.8 Å

PDB Description: Crystal structure of cloned trimeric hyluranidase from streptococcus pyogenes at 2.8 A resolution
PDB Compounds: (A:) hyaluronidase, phage associated

SCOPe Domain Sequences for d2yx2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yx2a2 b.108.1.5 (A:7-337) Phage-associated hyaluronidase, HylP1 {Streptococcus pyogenes [TaxId: 1314]}
lrvqfkrmkaaewarsdvilleseigfetdtgfaragdghnrfsdlgyispldynlltnk
pnidglatkvetaqklqqkadketvytkaeskqeldkklnlkggvmtgqlkfkpaatvay
ssstggavnidlsstrgagvvvysdndtsdgplmslrtgketfnqsalfvdykgttnavn
iamrqpttpnfssalnitsgnengsamqlrgsekalgtlkithenpsigadydknaaals
idivkktngagtaaqgiyinstsgttgkllrirnlsddkfyvksdggfyaketsqidgnl
klkdptandhaatkayvdkaiselkklilkk

SCOPe Domain Coordinates for d2yx2a2:

Click to download the PDB-style file with coordinates for d2yx2a2.
(The format of our PDB-style files is described here.)

Timeline for d2yx2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yx2a3