Lineage for d2yw7h1 (2yw7 H:17-157)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911056Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 911249Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
    Uniprot Q8VP75
  8. 911267Domain d2yw7h1: 2yw7 H:17-157 [153804]
    automatically matched to d1n1qa_
    mutant

Details for d2yw7h1

PDB Entry: 2yw7 (more details), 3.3 Å

PDB Description: Crystal structure of C-terminal deletion mutant of Mycobacterium smegmatis Dps
PDB Compounds: (H:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d2yw7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yw7h1 a.25.1.1 (H:17-157) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
vadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaeriatlg
kspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledldlvsqd
lliahagelekfqwfvrahle

SCOPe Domain Coordinates for d2yw7h1:

Click to download the PDB-style file with coordinates for d2yw7h1.
(The format of our PDB-style files is described here.)

Timeline for d2yw7h1: