Lineage for d2ysba2 (2ysb A:8-43)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811242Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2811243Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2811244Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2811340Protein automated matches [192459] (3 species)
    not a true protein
  7. 2811364Species Mouse (Mus musculus) [TaxId:10090] [161326] (2 PDB entries)
  8. 2811365Domain d2ysba2: 2ysb A:8-43 [153745]
    Other proteins in same PDB: d2ysba3, d2ysba4
    automated match to d2ysda_

Details for d2ysba2

PDB Entry: 2ysb (more details)

PDB Description: solution structure of the first ww domain from the mouse salvador homolog 1 protein (sav1)
PDB Compounds: (A:) Salvador homolog 1 protein

SCOPe Domain Sequences for d2ysba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ysba2 b.72.1.1 (A:8-43) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edlplppgwsvdwtmrgrkyyidhntntthwshple

SCOPe Domain Coordinates for d2ysba2:

Click to download the PDB-style file with coordinates for d2ysba2.
(The format of our PDB-style files is described here.)

Timeline for d2ysba2: