PDB entry 2ysb

View 2ysb on RCSB PDB site
Description: Solution structure of the first WW domain from the mouse salvador homolog 1 protein (SAV1)
Class: protein binding
Keywords: Salvador, WW domain, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2007-04-03, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salvador homolog 1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: Sav1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VEB2 (7-42)
      • expression tag (0-6)
      • expression tag (43-48)
    Domains in SCOPe 2.07: d2ysba2, d2ysba3, d2ysba4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ysbA (A:)
    gssgssgedlplppgwsvdwtmrgrkyyidhntntthwshplesgpssg