SCOP 1.75: Domain d2w0pb1: 2w0p B:2237-2328

Lineage for d2w0pb1 (2w0p B:2237-2328)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins)
   Pfam PF00630

6. Protein Filamin a [141023] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141024] (5 PDB entries)
   Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328

8. Domain d2w0pb1: 2w0p B:2237-2328 [153739]
   automatically matched to d2brqa1
   complexed with so4

Details for d2w0pb1

PDB Entry: 2w0p, 1.9 Å

PDB Description: crystal structure of the filamin a repeat 21 complexed with the migfilin peptide

PDB Compounds: (B:) Filamin-A

SCOP Domain Sequences for d2w0pb1:

Sequence; same for both SEQRES and ATOM records:

>d2w0pb1 b.1.18.10 (B:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
gahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgva
yvvqepgdyevsvkfneehipdspfvvpvasp

Timeline for d2w0pb1:

• d2w0pb1 is new in SCOP 1.75
  
• d2w0pb1 is called d2w0pb_ in SCOPe 2.01
  
• d2w0pb1 appears in the current release, SCOPe 2.08, called d2w0pb_