SCOPe 2.08: Domain d2w0pb_: 2w0p B:

Lineage for d2w0pb_ (2w0p B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein Filamin a [141023] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141024] (8 PDB entries)
   Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328

8. Domain d2w0pb_: 2w0p B: [153739]
   automated match to d2brqa1
   complexed with so4

Details for d2w0pb_

PDB Entry: 2w0p, 1.9 Å

PDB Description: crystal structure of the filamin a repeat 21 complexed with the migfilin peptide

PDB Compounds: (B:) Filamin-A

SCOPe Domain Sequences for d2w0pb_:

Sequence; same for both SEQRES and ATOM records:

>d2w0pb_ b.1.18.10 (B:) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps

Timeline for d2w0pb_:

• d2w0pb_ first appeared in SCOP 1.75, called d2w0pb1
  
• d2w0pb_ appears in SCOPe 2.07