Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Escherichia coli [TaxId:562] [55350] (9 PDB entries) Uniprot P06977 |
Domain d2vyvb2: 2vyv B:147-310 [153718] Other proteins in same PDB: d2vyva1, d2vyvb1, d2vyvc1 automated match to d1s7ca2 complexed with 1gp, fmt, nad |
PDB Entry: 2vyv (more details), 2.38 Å
SCOPe Domain Sequences for d2vyvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyvb2 d.81.1.1 (B:147-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} scttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipss tgaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegem kgvlgyteddvvstdfngevctsvfdakagialndnfvklvswy
Timeline for d2vyvb2:
View in 3D Domains from other chains: (mouse over for more information) d2vyva1, d2vyva2, d2vyvc1, d2vyvc2 |