Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) |
Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins) automatically mapped to Pfam PF02502 |
Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries) Uniprot Q79FD7 Rv2465c |
Domain d2vvqe_: 2vvq E: [153654] automated match to d1uslc_ complexed with r10, so4 |
PDB Entry: 2vvq (more details), 2 Å
SCOPe Domain Sequences for d2vvqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vvqe_ c.121.1.1 (E:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]} gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala ivdafvttpwskaqrhqrridilaeyertheappvpg
Timeline for d2vvqe_:
View in 3D Domains from other chains: (mouse over for more information) d2vvqa_, d2vvqb_, d2vvqc_, d2vvqd_ |