Lineage for d2vvqe_ (2vvq E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1630447Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 1630448Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 1630449Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
    automatically mapped to Pfam PF02502
  6. 1630450Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)
  7. 1630456Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries)
    Uniprot Q79FD7
    Rv2465c
  8. 1630476Domain d2vvqe_: 2vvq E: [153654]
    automated match to d1uslc_
    complexed with r10, so4

Details for d2vvqe_

PDB Entry: 2vvq (more details), 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis ribose-5-phosphate isomerase b in complex with the inhibitor 5-deoxy-5-phospho-d-ribonate
PDB Compounds: (E:) ribose-5-phosphate isomerase b

SCOPe Domain Sequences for d2vvqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvqe_ c.121.1.1 (E:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]}
gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
ivdafvttpwskaqrhqrridilaeyertheappvpg

SCOPe Domain Coordinates for d2vvqe_:

Click to download the PDB-style file with coordinates for d2vvqe_.
(The format of our PDB-style files is described here.)

Timeline for d2vvqe_: