SCOPe 2.07: Domain d2vvqa_: 2vvq A:

Lineage for d2vvqa_ (2vvq A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
   automatically mapped to Pfam PF02502

6. Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries)
   Uniprot Q79FD7
   Rv2465c

8. Domain d2vvqa_: 2vvq A: [153650]
   automated match to d1uslc_
   complexed with r10, so4

Details for d2vvqa_

PDB Entry: 2vvq, 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis ribose-5-phosphate isomerase b in complex with the inhibitor 5-deoxy-5-phospho-d-ribonate

PDB Compounds: (A:) ribose-5-phosphate isomerase b

SCOPe Domain Sequences for d2vvqa_:

Sequence; same for both SEQRES and ATOM records:

>d2vvqa_ c.121.1.1 (A:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]}
gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
ivdafvttpwskaqrhqrridilaeyertheappvpg

Timeline for d2vvqa_:

• d2vvqa_ first appeared in SCOP 1.75, called d2vvqa1
  
• d2vvqa_ appears in SCOPe 2.06
  
• d2vvqa_ appears in the current release, SCOPe 2.08