Lineage for d2vv5g2 (2vv5 G:180-280)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207554Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family) (S)
    the last strand of the fold is flipped away and involved in oligomerisation
  5. 1207555Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein)
  6. 1207556Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species)
  7. 1207557Species Escherichia coli [TaxId:562] [82692] (2 PDB entries)
  8. 1207564Domain d2vv5g2: 2vv5 G:180-280 [153632]
    Other proteins in same PDB: d2vv5a1, d2vv5a3, d2vv5b1, d2vv5b3, d2vv5c1, d2vv5c3, d2vv5d1, d2vv5d3, d2vv5e1, d2vv5e3, d2vv5f1, d2vv5f3, d2vv5g1, d2vv5g3
    automatically matched to d2oaua2

Details for d2vv5g2

PDB Entry: 2vv5 (more details), 3.45 Å

PDB Description: the open structure of mscs
PDB Compounds: (G:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2vv5g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vv5g2 d.58.43.1 (G:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli [TaxId: 562]}
repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv
wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv

SCOPe Domain Coordinates for d2vv5g2:

Click to download the PDB-style file with coordinates for d2vv5g2.
(The format of our PDB-style files is described here.)

Timeline for d2vv5g2: