Lineage for d2vusj1 (2vus J:671-712)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244274Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1244275Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1244276Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
    single zinc-binding motif
  6. 1244277Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 1244287Species Emericella nidulans [TaxId:162425] [161161] (3 PDB entries)
  8. 1244297Domain d2vusj1: 2vus J:671-712 [153566]
    Other proteins in same PDB: d2vusa_, d2vusb_, d2vusc_, d2vusd_, d2vuse_, d2vusf_, d2vusg_, d2vush_
    automatically matched to d4gata_
    protein/DNA complex; complexed with cl, so4, zn

Details for d2vusj1

PDB Entry: 2vus (more details), 2.6 Å

PDB Description: crystal structure of unliganded nmra-area zinc finger complex
PDB Compounds: (J:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vusj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vusj1 g.39.1.1 (J:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

SCOPe Domain Coordinates for d2vusj1:

Click to download the PDB-style file with coordinates for d2vusj1.
(The format of our PDB-style files is described here.)

Timeline for d2vusj1: