SCOPe 2.06: Domain d2vtuj1: 2vtu J:130-257

Lineage for d2vtuj1 (2vtu J:130-257)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
   Uniprot P03612

8. Domain d2vtuj1: 2vtu J:130-257 [153542]
   automatically matched to d1aq4a_

Details for d2vtuj1

PDB Entry: 2vtu, 3.5 Å

PDB Description: crystal structure of bacteriophage ms2 covalent coat protein dimer

PDB Compounds: (J:) ms2 coat protein

SCOPe Domain Sequences for d2vtuj1:

Sequence; same for both SEQRES and ATOM records:

>d2vtuj1 d.85.1.1 (J:130-257) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
anftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkytik
vevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpipsa
iaansgiy

Timeline for d2vtuj1:

• d2vtuj1 first appeared in SCOP 1.75
  
• d2vtuj1 appears in SCOPe 2.05
  
• d2vtuj1 appears in SCOPe 2.07
  
• d2vtuj1 appears in the current release, SCOPe 2.08