SCOPe 2.06: Domain d2vsla_: 2vsl A:

Lineage for d2vsla_ (2vsl A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (41 PDB entries)

8. Domain d2vsla_: 2vsl A: [153528]
   automated match to d2opya_
   complexed with 15p, zn

Details for d2vsla_

PDB Entry: 2vsl, 2.1 Å

PDB Description: crystal structure of xiap bir3 with a bivalent smac mimetic

PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d2vsla_:

Sequence; same for both SEQRES and ATOM records:

>d2vsla_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltd
wkpsedpweqhakwypgckylleqkgqeyinnihlt

Timeline for d2vsla_:

• d2vsla_ first appeared in SCOP 1.75, called d2vsla1
  
• d2vsla_ appears in SCOPe 2.05
  
• d2vsla_ appears in SCOPe 2.07
  
• d2vsla_ appears in the current release, SCOPe 2.08