Class g: Small proteins [56992] (94 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein automated matches [190700] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187840] (41 PDB entries) |
Domain d2vsla_: 2vsl A: [153528] automated match to d2opya_ complexed with 15p, zn |
PDB Entry: 2vsl (more details), 2.1 Å
SCOPe Domain Sequences for d2vsla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vsla_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltd wkpsedpweqhakwypgckylleqkgqeyinnihlt
Timeline for d2vsla_: