Lineage for d2vr1b1 (2vr1 B:331-446)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810849Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 810850Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 810857Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 810860Species Escherichia coli [TaxId:562] [51249] (7 PDB entries)
  8. 810870Domain d2vr1b1: 2vr1 B:331-446 [153492]
    Other proteins in same PDB: d2vr1a2, d2vr1a3, d2vr1b2, d2vr1b3
    automatically matched to d1bncb1
    complexed with atf, cl

Details for d2vr1b1

PDB Entry: 2vr1 (more details), 2.6 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with atp analog, adpcf2p.
PDB Compounds: (B:) biotin carboxylase

SCOP Domain Sequences for d2vr1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vr1b1 b.84.2.1 (B:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOP Domain Coordinates for d2vr1b1:

Click to download the PDB-style file with coordinates for d2vr1b1.
(The format of our PDB-style files is described here.)

Timeline for d2vr1b1: