| Class b: All beta proteins [48724] (180 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
| Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Escherichia coli [TaxId:562] [51249] (24 PDB entries) |
| Domain d2vr1b1: 2vr1 B:331-446 [153492] Other proteins in same PDB: d2vr1a2, d2vr1a3, d2vr1b2, d2vr1b3 automated match to d1dv1a1 complexed with atf, cl |
PDB Entry: 2vr1 (more details), 2.6 Å
SCOPe Domain Sequences for d2vr1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vr1b1 b.84.2.1 (B:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl
Timeline for d2vr1b1: