![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.33: NPCBM-like [158966] (3 proteins) Pfam PF08305 |
![]() | Protein automated matches [190905] (1 species) not a true protein |
![]() | Species Clostridium perfringens [TaxId:1502] [188350] (5 PDB entries) |
![]() | Domain d2vmia_: 2vmi A: [153328] automated match to d2vmga1 complexed with ca |
PDB Entry: 2vmi (more details), 1.7 Å
SCOPe Domain Sequences for d2vmia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vmia_ b.18.1.33 (A:) automated matches {Clostridium perfringens [TaxId: 1502]} etsvylselewksastgygeiqkdascdgntitlkgengekvsydkgigthahseivysl egldyydyfetfvgvdqemagtvasisfevyldnekvfdsglmtgdttqkhvkvpiagkn tlklvvkdggdsigsdhgsfgdaklt
Timeline for d2vmia_: