Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein automated matches [190401] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189906] (17 PDB entries) |
Domain d2vleb_: 2vle B: [153270] automated match to d1cw3a_ complexed with dzn |
PDB Entry: 2vle (more details), 2.4 Å
SCOPe Domain Sequences for d2vleb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vleb_ c.82.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccags rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt evktvtvkvpqkns
Timeline for d2vleb_: