SCOPe 2.07: Domain d2vl2b_: 2vl2 B:

Lineage for d2vl2b_ (2vl2 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187259] (20 PDB entries)

8. Domain d2vl2b_: 2vl2 B: [153249]
   Other proteins in same PDB: d2vl2a3
   automated match to d1oc3a_
   complexed with bez

Details for d2vl2b_

PDB Entry: 2vl2, 1.92 Å

PDB Description: oxidized and reduced forms of human peroxiredoxin 5

PDB Compounds: (B:) peroxiredoxin-5

SCOPe Domain Sequences for d2vl2b_:

Sequence; same for both SEQRES and ATOM records:

>d2vl2b_ c.47.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

Timeline for d2vl2b_:

• d2vl2b_ first appeared in SCOP 1.75, called d2vl2b1
  
• d2vl2b_ appears in SCOPe 2.06
  
• d2vl2b_ appears in the current release, SCOPe 2.08