SCOPe 2.08: Domain d2vkwb2: 2vkw B:601-691

Lineage for d2vkwb2 (2vkw B:601-691)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries)
   Uniprot P13592 498-598

8. Domain d2vkwb2: 2vkw B:601-691 [153235]
   Other proteins in same PDB: d2vkwa3, d2vkwb3
   automatically matched to d1lwra_
   complexed with so4

Details for d2vkwb2

PDB Entry: 2vkw, 2.3 Å

PDB Description: human ncam, fn3 domains 1 and 2

PDB Compounds: (B:) neural cell adhesion molecule 1,140 kda isoform

SCOPe Domain Sequences for d2vkwb2:

Sequence; same for both SEQRES and ATOM records:

>d2vkwb2 b.1.2.1 (B:601-691) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
psapklegqmgedgnsikvnlikqddggspirhylvryralssewkpeirlpsgsdhvml
ksldwnaeyevyvvaenqqgkskaahfvfrt

Timeline for d2vkwb2:

• d2vkwb2 first appeared in SCOP 1.75
  
• d2vkwb2 appears in SCOPe 2.07