Lineage for d2vkdb_ (2vkd B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178199Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1178200Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1178879Family c.68.1.22: Glycosylating toxin catalytic domain-like [159726] (4 proteins)
    contains Glycosyltransferase sugar-binding region containing DXD motif, Pfam PF04488
  6. 1178890Protein automated matches [190532] (2 species)
    not a true protein
  7. 1178893Species Clostridium sordellii [TaxId:1505] [188384] (3 PDB entries)
  8. 1178900Domain d2vkdb_: 2vkd B: [153219]
    Other proteins in same PDB: d2vkda1, d2vkdc_
    automated match to d2bvla1
    complexed with mn, upg

Details for d2vkdb_

PDB Entry: 2vkd (more details), 2.53 Å

PDB Description: crystal structure of the catalytic domain of lethal toxin from clostridium sordellii in complex with udp-glc and manganese ion
PDB Compounds: (B:) cytotoxin l

SCOPe Domain Sequences for d2vkdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkdb_ c.68.1.22 (B:) automated matches {Clostridium sordellii [TaxId: 1505]}
lvnkaqlqkmayvkfriqedeyvailnaleeyhnmsessvvekylklkdinnltdnylnt
ykksgrnkalkkfkeyltmevlelknnsltpveknlhfiwiggqindtainyinqwkdvn
sdytvkvfydsnaflintlkktivesatnntlesfrenlndpefdynkfyrkrmeiiydk
qkhfidyyksqieenpefiidniiktylsneyskdlealnkyieeslnkitanngndirn
lekfadedlvrlynqelverwnlaaasdilrismlkedggvyldvdmlpgiqpdlfksin
kpdsitntswemikleaimkykeyipgytsknfdmldeevqrsfesalssksdkseiflp
lddikvsplevkiafannsvinqalislkdsycsdlvinqiknrykilndnlnpsinegt
dfnttmkifsdklasisnednmmfmikitnylkvgfapdvrstinlsgpgvytgayqdll
mfkdnstnihllepelrnfefpktkisqlteqeitslwsfnqaraksqfeeykkgyfe

SCOPe Domain Coordinates for d2vkdb_:

Click to download the PDB-style file with coordinates for d2vkdb_.
(The format of our PDB-style files is described here.)

Timeline for d2vkdb_: