Lineage for d2vjbb1 (2vjb B:4-535)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 841868Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)
  6. 841869Protein Acetylcholinesterase [53476] (5 species)
  7. 841925Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (68 PDB entries)
    Uniprot P04058 25-556
  8. 841953Domain d2vjbb1: 2vjb B:4-535 [153189]
    automatically matched to d1evea_
    complexed with ccd, cl, nag, pge

Details for d2vjbb1

PDB Entry: 2vjb (more details), 2.39 Å

PDB Description: torpedo californica acetylcholinesterase in complex with a non hydrolysable substrate analogue, 4-oxo-n,n,n- trimethylpentanaminium - orthorhombic space group - dataset d at 100k
PDB Compounds: (B:) acetylcholinesterase

SCOP Domain Sequences for d2vjbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjbb1 c.69.1.1 (B:4-535) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOP Domain Coordinates for d2vjbb1:

Click to download the PDB-style file with coordinates for d2vjbb1.
(The format of our PDB-style files is described here.)

Timeline for d2vjbb1: