Lineage for d2vhou1 (2vho U:3-53)

  1. Root: SCOPe 2.04
  2. 1713148Class j: Peptides [58231] (126 folds)
  3. 1715010Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1715011Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 1715012Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 1715013Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 1715014Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 1715035Domain d2vhou1: 2vho U:3-53 [153143]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1
    automatically matched to 2AVY U:3-53
    protein/RNA complex; complexed with mg

Details for d2vhou1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2vhou1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhou1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2vhou1:

Click to download the PDB-style file with coordinates for d2vhou1.
(The format of our PDB-style files is described here.)

Timeline for d2vhou1: