Lineage for d2ve9e_ (2ve9 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307785Family a.4.5.67: FtsK C-terminal domain-like [140295] (2 proteins)
    PfamB PB000224
    automatically mapped to Pfam PF09397
  6. 2307791Protein automated matches [190361] (1 species)
    not a true protein
  7. 2307792Species Pseudomonas aeruginosa [TaxId:287] [187192] (2 PDB entries)
  8. 2307805Domain d2ve9e_: 2ve9 E: [153020]
    automated match to d2j5oa1
    complexed with mg

Details for d2ve9e_

PDB Entry: 2ve9 (more details), 1.9 Å

PDB Description: xray structure of kops bound gamma domain of ftsk (p. aeruginosa)
PDB Compounds: (E:) DNA translocase ftsk

SCOPe Domain Sequences for d2ve9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve9e_ a.4.5.67 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsreviap
apv

SCOPe Domain Coordinates for d2ve9e_:

Click to download the PDB-style file with coordinates for d2ve9e_.
(The format of our PDB-style files is described here.)

Timeline for d2ve9e_: