Class a: All alpha proteins [46456] (286 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins) Pfam PF01468; also includes FIVAR module, Pfam PF07554 |
Protein automated matches [190362] (1 species) not a true protein |
Species Peptostreptococcus magnus [TaxId:1260] [187194] (2 PDB entries) |
Domain d2vdbb_: 2vdb B: [152972] Other proteins in same PDB: d2vdba1, d2vdba2, d2vdba3 automated match to d1gaba_ complexed with dka, nps |
PDB Entry: 2vdb (more details), 2.52 Å
SCOPe Domain Sequences for d2vdbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdbb_ a.8.1.2 (B:) automated matches {Peptostreptococcus magnus [TaxId: 1260]} hmtidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha
Timeline for d2vdbb_: