| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class sigma GST [81362] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89705] (13 PDB entries) Uniprot O60760 synonym: hematopoietic prostaglandin D synthase |
| Domain d2vczb2: 2vcz B:2-75 [152949] Other proteins in same PDB: d2vcza1, d2vczb1, d2vczc1, d2vczd1 automatically matched to d1iyha2 complexed with gsh, vc3 |
PDB Entry: 2vcz (more details), 1.95 Å
SCOPe Domain Sequences for d2vczb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vczb2 c.47.1.5 (B:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt
Timeline for d2vczb2: