Lineage for d2vczc2 (2vcz C:2-75)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1369136Protein Class sigma GST [81362] (5 species)
  7. 1369149Species Human (Homo sapiens) [TaxId:9606] [89705] (13 PDB entries)
    Uniprot O60760
    synonym: hematopoietic prostaglandin D synthase
  8. 1369176Domain d2vczc2: 2vcz C:2-75 [152951]
    Other proteins in same PDB: d2vcza1, d2vczb1, d2vczc1, d2vczd1
    automatically matched to d1iyha2
    complexed with gsh, vc3

Details for d2vczc2

PDB Entry: 2vcz (more details), 1.95 Å

PDB Description: complex structure of prostaglandin d2 synthase at 1.95a.
PDB Compounds: (C:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vczc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vczc2 c.47.1.5 (C:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d2vczc2:

Click to download the PDB-style file with coordinates for d2vczc2.
(The format of our PDB-style files is described here.)

Timeline for d2vczc2: