Lineage for d2vcqc2 (2vcq C:2-75)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602752Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries)
  8. 1602842Domain d2vcqc2: 2vcq C:2-75 [152927]
    Other proteins in same PDB: d2vcqa1, d2vcqb1, d2vcqc1, d2vcqd1
    automated match to d1pd212
    complexed with d25, gsh

Details for d2vcqc2

PDB Entry: 2vcq (more details), 1.95 Å

PDB Description: complex structure of prostaglandin d2 synthase at 1.95a.
PDB Compounds: (C:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vcqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcqc2 c.47.1.0 (C:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d2vcqc2:

Click to download the PDB-style file with coordinates for d2vcqc2.
(The format of our PDB-style files is described here.)

Timeline for d2vcqc2: