Lineage for d2v97b_ (2v97 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1382313Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 1382314Protein Acetylcholinesterase [53476] (5 species)
  7. 1382379Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (76 PDB entries)
    Uniprot P04058 25-556
  8. 1382461Domain d2v97b_: 2v97 B: [152800]
    automated match to d1evea_
    complexed with cfq, cl, nag

Details for d2v97b_

PDB Entry: 2v97 (more details), 2.4 Å

PDB Description: structure of the unphotolysed complex of tcache with 1-(2- nitrophenyl)-2,2,2-trifluoroethyl-arsenocholine after a 9 seconds annealing to room temperature
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d2v97b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v97b_ c.69.1.1 (B:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOPe Domain Coordinates for d2v97b_:

Click to download the PDB-style file with coordinates for d2v97b_.
(The format of our PDB-style files is described here.)

Timeline for d2v97b_: