SCOPe 2.02: Domain d2v7wc1: 2v7w C:193-298

Lineage for d2v7wc1 (2v7w C:193-298)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (1 family)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (14 PDB entries)

8. Domain d2v7wc1: 2v7w C:193-298 [152759]
   Other proteins in same PDB: d2v7wa2, d2v7wb2, d2v7wc2
   automatically matched to d1rqpa1
   complexed with 5fd; mutant

Details for d2v7wc1

PDB Entry: 2v7w, 1.9 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with 5'-fluorodeoxyadenosin

PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2v7wc1:

Sequence; same for both SEQRES and ATOM records:

>d2v7wc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d2v7wc1:

• d2v7wc1 first appeared in SCOP 1.75
  
• d2v7wc1 appears in SCOPe 2.01
  
• d2v7wc1 appears in SCOPe 2.03
  
• d2v7wc1 appears in the current release, SCOPe 2.08