Lineage for d2v7vc1 (2v7v C:193-298)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824820Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 2824821Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 2824822Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)
  6. 2824823Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)
  7. 2824824Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)
  8. 2824836Domain d2v7vc1: 2v7v C:193-298 [152753]
    Other proteins in same PDB: d2v7va2, d2v7vb2, d2v7vc2
    automated match to d1rqpa1
    complexed with 5fd

Details for d2v7vc1

PDB Entry: 2v7v (more details), 1.94 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'-fluorodeoxyadenosine
PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2v7vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7vc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

SCOPe Domain Coordinates for d2v7vc1:

Click to download the PDB-style file with coordinates for d2v7vc1.
(The format of our PDB-style files is described here.)

Timeline for d2v7vc1: