SCOPe 2.01: Domain d2v7qj1: 2v7q J:8-40

Lineage for d2v7qj1 (2v7q J:8-40)

1. Root: SCOPe 2.01

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.8: F1 ATPase inhibitor, IF1, C-terminal domain [64602] (1 family)

5. Family h.4.8.1: F1 ATPase inhibitor, IF1, C-terminal domain [64603] (1 protein)

6. Protein F1 ATPase inhibitor, IF1, C-terminal domain [64604] (1 species)
   antiparallel right-handed coiled-coil

7. Species Cow (Bos taurus) [TaxId:9913] [64605] (4 PDB entries)

8. Domain d2v7qj1: 2v7q J:8-40 [152736]
   Other proteins in same PDB: d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_
   automatically matched to d1ohhh_
   complexed with adp, atp, mg, po4

Details for d2v7qj1

PDB Entry: 2v7q, 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.

PDB Compounds: (J:) ATPase inhibitor

SCOPe Domain Sequences for d2v7qj1:

Sequence; same for both SEQRES and ATOM records:

>d2v7qj1 h.4.8.1 (J:8-40) F1 ATPase inhibitor, IF1, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
vrssagavrdaggafgkreqaeeeryfrarake

Timeline for d2v7qj1:

• d2v7qj1 first appeared in SCOP 1.75
  
• d2v7qj1 appears in SCOPe 2.02
  
• d2v7qj1 appears in the current release, SCOPe 2.08, called d2v7qj_