Lineage for d2v68i_ (2v68 I:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656663Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1656664Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1656665Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1656823Protein automated matches [190066] (5 species)
    not a true protein
  7. 1656824Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries)
  8. 1656857Domain d2v68i_: 2v68 I: [152660]
    Other proteins in same PDB: d2v68a1, d2v68a2, d2v68b1, d2v68b2, d2v68c1, d2v68c2, d2v68d1, d2v68d2, d2v68e1, d2v68e2, d2v68f1, d2v68f2, d2v68g1, d2v68g2, d2v68h1, d2v68h2
    automated match to d1ir21_
    complexed with cap, edo, mg; mutant

Details for d2v68i_

PDB Entry: 2v68 (more details), 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with large- subunit mutations v331a, t342i
PDB Compounds: (I:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2v68i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v68i_ d.73.1.1 (I:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2v68i_:

Click to download the PDB-style file with coordinates for d2v68i_.
(The format of our PDB-style files is described here.)

Timeline for d2v68i_: