Lineage for d2v67e1 (2v67 E:150-475)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447081Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2447082Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2447312Protein automated matches [226984] (16 species)
    not a true protein
  7. 2447326Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries)
  8. 2447347Domain d2v67e1: 2v67 E:150-475 [152628]
    Other proteins in same PDB: d2v67a2, d2v67b2, d2v67c2, d2v67d2, d2v67e2, d2v67f2, d2v67g2, d2v67h2, d2v67i_, d2v67j_, d2v67k_, d2v67l_, d2v67m_, d2v67n_, d2v67o_, d2v67p_
    automated match to d1gk8a1
    complexed with cap, edo, mg; mutant

Details for d2v67e1

PDB Entry: 2v67 (more details), 2 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit supressor mutation t342i
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v67e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v67e1 c.1.14.1 (E:150-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevilgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d2v67e1:

Click to download the PDB-style file with coordinates for d2v67e1.
(The format of our PDB-style files is described here.)

Timeline for d2v67e1: