Lineage for d2v63i_ (2v63 I:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419773Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1419774Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1419775Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1419933Protein automated matches [190066] (5 species)
    not a true protein
  7. 1419934Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries)
  8. 1419943Domain d2v63i_: 2v63 I: [152609]
    Other proteins in same PDB: d2v63a1, d2v63a2, d2v63b1, d2v63b2, d2v63c1, d2v63c2, d2v63d1, d2v63d2, d2v63e1, d2v63e2, d2v63f1, d2v63f2, d2v63g1, d2v63g2, d2v63h1, d2v63h2
    automated match to d1ir21_
    complexed with cap, edo, mg; mutant

Details for d2v63i_

PDB Entry: 2v63 (more details), 1.8 Å

PDB Description: Crystal structure of Rubisco from Chlamydomonas reinhardtii with a large-subunit V331A mutation
PDB Compounds: (I:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2v63i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v63i_ d.73.1.1 (I:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2v63i_:

Click to download the PDB-style file with coordinates for d2v63i_.
(The format of our PDB-style files is described here.)

Timeline for d2v63i_: